Peptide YY (3-36) human - CAS 123583-37-9
Category: Inhibitor
Please be kindly noted products are not for therapeutic use. We do not sell to patients.
Molecular Formula:
C180H279N53O54
Molecular Weight:
4049.51
COA:
Inquire
Targets:
Neuropeptide Y receptor
Description:
Peptide YY (3-36) human, a short (36-amino acid) peptide released by cells in the ileum and colon in response to feeding, is a NPY Y2 receptor agonist. PYY (3-36) has been associated with dose-dependent weight loss in various obesity models including ob/ob mice, diet-induced obese mice, and non-diabetic fatty Zucker rats.
Sequence:
IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY
(Modifications: Tyr-34 = C-terminal amide)
Synonyms:
IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY; Pancreatic Peptide YY; Peptide Tyrosine Tyrosine
Storage:
Store in a cool and dry place (or refer to the Certificate of Analysis).
MSDS:
Inquire
InChIKey:
AUHJXHCVECGTKR-RIBGVNDISA-N
InChI:
InChI=1S/C180H279N53O54/c1-17-91(12)141(185)171(282)214-114(27-18-19-61-181)175(286)232-67-25-33-130(232)169(280)211-111(53-58-137(247)248)147(258)204-94(15)174(285)231-66-24-32-129(231)168(279)200-82-135(244)205-109(52-57-136(245)246)152(263)226-126(80-140(253)254)157(268)203-93(14)146(257)228-128(84-235)176(287)233-68-26-34-131(233)170(281)212-113(55-60-139(251)252)154(265)210-112(54-59-138(249)250)155(266)216-117(70-87(4)5)159(270)224-124(78-133(183)242)164(275)208-106(29-21-63-197-178(189)190)150(261)220-121(75-98-39-47-103(239)48-40-98)162(273)221-120(74-97-37-45-102(238)46-38-97)156(267)202-92(13)145(256)227-127(83-234)167(278)219-116(69-86(2)3)158(269)207-107(30-22-64-198-179(191)192)151(262)223-123(77-100-81-195-85-201-100)163(274)222-122(76-99-41-49-104(240)50-42-99)161(272)217-118(71-88(6)7)160(271)225-125(79-134(184)243)165(276)218-119(72-89(8)9)166(277)229-142(90(10)11)172(283)230-143(95(16)236)173(284)213-108(31-23-65-199-180(193)194)148(259)209-110(51-56-132(182)241)153(264)206-105(28-20-62-196-177(187)188)149(260)215-115(144(186)255)73-96-35-43-101(237)44-36-96/h35-50,81,85-95,105-131,141-143,234-240H,17-34,51-80,82-84,181,185H2,1-16H3,(H2,182,241)(H2,183,242)(H2,184,243)(H2,186,255)(H,195,201)(H,200,279)(H,202,267)(H,203,268)(H,204,258)(H,205,244)(H,206,264)(H,207,269)(H,208,275)(H,209,259)(H,210,265)(H,211,280)(H,212,281)(H,213,284)(H,214,282)(H,215,260)(H,216,266)(H,217,272)(H,218,276)(H,219,278)(H,220,261)(H,221,273)(H,222,274)(H,223,262)(H,224,270)(H,225,271)(H,226,263)(H,227,256)(H,228,257)(H,229,277)(H,230,283)(H,245,246)(H,247,248)(H,249,250)(H,251,252)(H,253,254)(H4,187,188,196)(H4,189,190,197)(H4,191,192,198)(H4,193,194,199)/t91-,92-,93-,94-,95+,105-,106-,107-,108-,109-,110-,111-,112-,113-,114-,115-,116-,117-,118-,119-,120-,121-,122-,123-,124-,125-,126-,127-,128-,129-,130-,131-,141-,142-,143-/m0/s1
Canonical SMILES:
CCC(C)C(C(=O)NC(CCCCN)C(=O)N1CCCC1C(=O)NC(CCC(=O)O)C(=O)NC(C)C(=O)N2CCCC2C(=O)NCC(=O)NC(CCC(=O)O)C(=O)NC(CC(=O)O)C(=O)NC(C)C(=O)NC(CO)C(=O)N3CCCC3C(=O)NC(CCC(=O)O)C(=O)NC(CCC(=O)O)C(=O)NC(CC(C)C)C(=O)NC(CC(=O)N)C(=O)NC(CCCNC(=N)N)C(=O)NC(CC4=CC=C(C=C4)O)C(=O)NC(CC5=CC=C(C=C5)O)C(=O)NC(C)C(=O)NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CCCNC(=N)N)C(=O)NC(CC6=CNC=N6)C(=O)NC(CC7=CC=C(C=C7)O)C(=O)NC(CC(C)C)C(=O)NC(CC(=O)N)C(=O)NC(CC(C)C)C(=O)NC(C(C)C)C(=O)NC(C(C)O)C(=O)NC(CCCNC(=N)N)C(=O)NC(CCC(=O)N)C(=O)NC(CCCNC(=N)N)C(=O)NC(CC8=CC=C(C=C8)O)C(=O)N)N
Molecular Weight Calculator Molarity Calculator Solution Dilution Calculator

Related Neuropeptide Y receptor Products


CAS 113662-54-7 Neuropeptide Y 13-36 (porcine)

Neuropeptide Y 13-36 (porcine)
(CAS: 113662-54-7)

Neuropeptide Y 13-36 (porcine) is a selective neuropeptide Y2 receptor agonist (Ki = 0.18 nM). It mimics the effects of NPY at presynaptic receptors in vas defe...

CAS 443292-81-7 SF 11

SF 11
(CAS: 443292-81-7)

SF 11 is a selective and brain penetrating neuropeptide Y (NPY) Y2 antagonist (IC50 = 199 nM) displaying no affinity for Y1 receptor at concentrations up to 35 ...

CAS 126339-09-1 Peptide YY (3-36)

Peptide YY (3-36)
(CAS: 126339-09-1)

Peptide YY (3-36) is a Y2/Y5 Neuropeptide Y receptor agonist (IC50= 0.11 nM for inhibition of 125I-PYY binding to Y2 receptor). Human peptide YY (PYY) has roles...

BIBP 3226 trifluoroacetate
(CAS: 1068148-47-9)

BIBP 3226 trifluoroacetate is a mixed non-peptide neuropeptide Y Y1 (NPY Y1) and neuropeptide FF (NPFF) receptor antagonist (Ki = 1.1, 79, 108, > 1000, > 1000 a...

CAS 181468-88-2 PD 160170

PD 160170
(CAS: 181468-88-2)

PD 160170 is a potent, selective non-peptidic neuropeptide Y1 receptor antagonist (Ki = 48 nM), which is selective over Y2 and Y5 receptors (Ki > 10 μM).

CAS 153549-84-9 [D-Trp34]-Neuropeptide Y

[D-Trp34]-Neuropeptide Y
(CAS: 153549-84-9)

[D-Trp34]-Neuropeptide Y is a potent and selective NPY Y(5) receptor agonist (pEC50= 7.82, 6.28, 6.44 and > 6 at rat Y5, Y4, Y1 and Y2 receptors respectively), ...

CAS 447405-11-0 FR252384

FR252384
(CAS: 447405-11-0)

FR252384 is novel potent antagonists of human neuropeptide Y-Y5 receptor (IC50= 2.3 nM).

CAS 6508-43-6 L-152,804

L-152,804
(CAS: 6508-43-6)

L-152,804 is a potent and selective orally available non-peptide neuropeptide Y Y5 receptor antagonist with Ki value of 26 nM for hY5. It displays > 300-fold se...

Chemical Structure

CAS 123583-37-9 Peptide YY (3-36) human

Quick Inquiry

Verification code

Featured Items