Peptide YY (3-36) human - CAS 123583-37-9
Category: Inhibitor
Please be kindly noted products are not for therapeutic use. We do not sell to patients.
Molecular Formula:
Molecular Weight:
Neuropeptide Y receptor
Peptide YY (3-36) human, a short (36-amino acid) peptide released by cells in the ileum and colon in response to feeding, is a NPY Y2 receptor agonist. PYY (3-36) has been associated with dose-dependent weight loss in various obesity models including ob/ob mice, diet-induced obese mice, and non-diabetic fatty Zucker rats.
(Modifications: Tyr-34 = C-terminal amide)
IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY; Pancreatic Peptide YY; Peptide Tyrosine Tyrosine
Store in a cool and dry place (or refer to the Certificate of Analysis).
Canonical SMILES:
Molecular Weight Calculator Molarity Calculator Solution Dilution Calculator

Related Neuropeptide Y receptor Products

CAS 83589-17-7 Neuropeptide Y (porcine)

Neuropeptide Y (porcine)
(CAS: 83589-17-7)

Neuropeptide Y (porcine) is a widely distributed endogenous neuropeptide involved in regulation of circadian rhythms, sexual functioning, anxiety and stress res...

CAS 1094873-14-9 JNJ-31020028

(CAS: 1094873-14-9)

JNJ-31020028 is a selective brain penetrant small molecule antagonist of the neuropeptide Y Y(2) receptor. JNJ-31020028 bound with high affinity (IC50 = 8.07, h...

CAS 138579-66-5 Galantide

(CAS: 138579-66-5)

Galantide, a neuropeptide, is a reversible and non-specific galanin receptor antagonist. Galantide showed a more than 10-fold higher<br/>affinity to the galanin...

CAS 132699-73-1 [Leu31,Pro34]-Neuropeptide Y (human, rat)

[Leu31,Pro34]-Neuropeptide Y (human, rat
(CAS: 132699-73-1)

[Leu31,Pro34]-Neuropeptide Y (human, rat) is a high affinity neuropeptide Y Y1 receptor agonist (Ki = 0.39 nM).

CAS 123583-37-9 Peptide YY (3-36) human

Peptide YY (3-36) human
(CAS: 123583-37-9)

Peptide YY (3-36) human, a short (36-amino acid) peptide released by cells in the ileum and colon in response to feeding, is a NPY Y2 receptor agonist. PYY (3-3...

CAS 230960-31-3 Neuropeptide SF (mouse, rat)

Neuropeptide SF (mouse, rat)
(CAS: 230960-31-3)

Neuropeptide SF (mouse, rat) is a neuropeptide FF receptor agonist (Ki= 48.4 and 12.1 nM for NPFF1 and NPFF2, respectively). NPSF may play a physiologic role in...

CAS 143896-17-7 M40

(CAS: 143896-17-7)

M40 is a potent, non-selective antagonist of galanin receptor, and has no effect on chow or fat intake.

CAS 304008-29-5 LU AA33810

LU AA33810
(CAS: 304008-29-5)

LU AA33810 is a neuropeptide Y Y5 receptor antagonist. It exhibits anxiolytic- and antidepressant-like effects in rat models of stress sensitivity.

Chemical Structure

CAS 123583-37-9 Peptide YY (3-36) human

Quick Inquiry

Verification code

Featured Items