pembrolizumab - CAS 1374853-91-4
Catalog number: B0084-470958
Category: Inhibitor
Please be kindly noted products are not for therapeutic use. We do not sell to patients.
COA:
Inquire
Targets:
PD-1
Description:
Pembrolizumab (formerly MK-3475 and lambrolizumab, trade name Keytruda) is a humanized antibody used in cancer immunotherapy. It targets the programmed cell death 1 (PD-1) receptor. The drug was initially used in treating metastatic melanoma.
Brife Description:
A humanized antibody targeting PD-1 receptor used in cancer immunotherapy.
Sequence:
Light Chain Sequence:
EIVLTQSPATLSLSPGERATLSCRASKGVSTSGYSYLHWYQQKPGQAPRLLIYLASYLES
GVPARFSGSGSGTDFTLTISSLEPEDFAVYYCQHSRDLPLTFGGGTKVEIKRTVAAPSVF
IFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLS
STLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Heavy Chain Sequence:
QVQLVQSGVEVKKPGASVKVSCKASGYTFTNYYMYWVRQAPGQGLEWMGGINPSNGGTNF
NEKFKNRVTLTTDSSTTTAYMELKSLQFDDTAVYYCARRDYRFDMGFDYWGQGTTVTVSS
ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS
GLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSV
FLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTY
RVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTK
NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEG
NVFSCSVMHEALHNHYTQKSLSLSLGK
Synonyms:
Anti-PD-1 monoclonal antibody - Merck; Humanised monoclonal IgG4 antibody against PD-1 - Merck; Keytruda; Lambrolizumab; MK-3475; MK 3475; MK3475; SCH-900475; SCH 900475; SCH900475
MSDS:
Inquire
Quality Standard:
In-house
Quantity:
Milli-Grams
Current Developer:
Advaxis; Amgen; DNAtrix; Eisai Co Ltd; Eli Lilly; Fox Chase Cancer Center; Hoosier Cancer Research Network; ImmunoGen; Incyte Corporation; M. D. Anderson Cancer Center; Massachusetts General Hospital; Memorial Sloan-Kettering Cancer Center; Merck & Co; National Cancer Institute (USA); Northwestern University; Plexxikon; Providence Health & Services; TG Therapeutics Inc; University of Pittsburgh; Washington University School of Medicine; Yale University
Molecular Weight Calculator Molarity Calculator Solution Dilution Calculator

Related PD-1 Products


AMP-224

A fusion protein that contains the extracellular domain of PD-1 ligand 2 (B7-DC; PDCDILG2) and the Fc region of human immunoglobulin (Ig) G1. AMP-224 does not ...

pembrolizumab
(CAS: 1374853-91-4)

Pembrolizumab (formerly MK-3475 and lambrolizumab, trade name Keytruda) is a humanized antibody used in cancer immunotherapy. It targets the programmed cell dea...

Pidilizumab
(CAS: 1036730-42-3)

A humanized, immunoglobulin (Ig) G1 monoclonal antibody directed against human inhibitory receptor programmed cell death 1 (PD-1; PDCD1), with potential immune ...

nivolumab
(CAS: 946414-94-4)

Nivolumab, marketed as Opdivo, is a humanized IgG4 anti-PD-1 monoclonal antibody used to treat cancer. Nivolumab works as a checkpoint inhibitor, blocking a sig...

tislelizumab

Tislelizumab is a humanized monoclonal antibody (MAb) that targets PD-1 to prevent it binding to PD-L1 and PD-L2. Tislelizumab is developed for the treatment of...

MEDI0680

A humanized immunoglobulin (Ig) G4 monoclonal antibody directed against the negative immunoregulatory human cell surface receptor programmed cell death 1 (PD-1)...

Quick Inquiry

Verification code

Featured Items