Parstatin (human) - CAS 1065755-99-8
Category: Inhibitor
Please be kindly noted products are not for therapeutic use. We do not sell to patients.
Molecular Formula:
C191H330N64O53S3
Molecular Weight:
4467.29
COA:
Inquire
Targets:
PARP
Description:
Parstatin is a 41-amino acid peptide, formed by proteolytic cleavage on activation of the protease activated receptor-1, with antiangiogenic properties. Parstatin (human) attenuates endothelial cell migration and proliferation (IC50 ~ 3 μM), and induces cell cycle arrest. It promotes activation of caspase-3 and exhibits pro-apoptotic activity in vitro.
Sequence:
MGPRRLLLVAACFSLCGPLLSARTRARRPESKATNATLDPR
Synonyms:
MGPRRLLLVAACFSLCGPLLSARTRARRPESKATNATLDPR
Storage:
Store in a cool and dry place (or refer to the Certificate of Analysis).
MSDS:
Inquire
InChIKey:
SVAINNLHALEEHP-HQNSSEMESA-N
InChI:
InChI=1S/C191H330N64O53S3/c1-90(2)73-118(233-158(281)112(48-34-63-211-187(199)200)226-156(279)113(49-35-64-212-188(201)202)228-174(297)133-53-39-68-252(133)138(263)83-216-152(275)108(193)59-72-311-26)162(285)234-119(74-91(3)4)163(286)236-124(79-96(13)14)169(292)248-142(97(15)16)178(301)223-98(17)146(269)218-99(18)149(272)246-132(89-310)173(296)238-125(80-107-43-28-27-29-44-107)168(291)245-130(87-258)172(295)237-121(76-93(7)8)167(290)247-131(88-309)153(276)217-84-139(264)253-69-40-54-134(253)175(298)239-122(77-94(9)10)164(287)235-120(75-92(5)6)166(289)244-128(85-256)170(293)222-101(20)148(271)225-114(50-36-65-213-189(203)204)160(283)251-145(106(25)261)179(302)230-110(46-32-61-209-185(195)196)155(278)219-100(19)147(270)224-111(47-33-62-210-186(197)198)157(280)231-116(51-37-66-214-190(205)206)182(305)254-70-41-55-135(254)176(299)229-115(57-58-140(265)266)159(282)243-129(86-257)171(294)227-109(45-30-31-60-192)154(277)220-102(21)150(273)250-144(105(24)260)181(304)241-126(81-137(194)262)161(284)221-103(22)151(274)249-143(104(23)259)180(303)240-123(78-95(11)12)165(288)242-127(82-141(267)268)183(306)255-71-42-56-136(255)177(300)232-117(184(307)308)52-38-67-215-191(207)208/h27-29,43-44,90-106,108-136,142-145,256-261,309-310H,30-42,45-89,192-193H2,1-26H3,(H2,194,262)(H,216,275)(H,217,276)(H,218,269)(H,219,278)(H,220,277)(H,221,284)(H,222,293)(H,223,301)(H,224,270)(H,225,271)(H,226,279)(H,227,294)(H,228,297)(H,229,299)(H,230,302)(H,231,280)(H,232,300)(H,233,281)(H,234,285)(H,235,287)(H,236,286)(H,237,295)(H,238,296)(H,239,298)(H,240,303)(H,241,304)(H,242,288)(H,243,282)(H,244,289)(H,245,291)(H,246,272)(H,247,290)(H,248,292)(H,249,274)(H,250,273)(H,251,283)(H,265,266)(H,267,268)(H,307,308)(H4,195,196,209)(H4,197,198,210)(H4,199,200,211)(H4,201,202,212)(H4,203,204,213)(H4,205,206,214)(H4,207,208,215)
Canonical SMILES:
CC(C)CC(C(=O)NC(CC(C)C)C(=O)NC(CO)C(=O)NC(C)C(=O)NC(CCCNC(=N)N)C(=O)NC(C(C)O)C(=O)NC(CCCNC(=N)N)C(=O)NC(C)C(=O)NC(CCCNC(=N)N)C(=O)NC(CCCNC(=N)N)C(=O)N1CCCC1C(=O)NC(CCC(=O)O)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(C)C(=O)NC(C(C)O)C(=O)NC(CC(=O)N)C(=O)NC(C)C(=O)NC(C(C)O)C(=O)NC(CC(C)C)C(=O)NC(CC(=O)O)C(=O)N2CCCC2C(=O)NC(CCCNC(=N)N)C(=O)O)NC(=O)C3CCCN3C(=O)CNC(=O)C(CS)NC(=O)C(CC(C)C)NC(=O)C(CO)NC(=O)C(CC4=CC=CC=C4)NC(=O)C(CS)NC(=O)C(C)NC(=O)C(C)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC(C)C)NC(=O)C(CCCNC(=N)N)NC(=O)C(CCCNC(=N)N)NC(=O)C5CCCN5C(=O)CNC(=O)C(CCSC)N
Molecular Weight Calculator Molarity Calculator Solution Dilution Calculator

Related PARP Products


CAS 1345098-78-3 XMD16-5

XMD16-5
(CAS: 1345098-78-3)

XMD16-5is a novel non-receptor tyrosine kinase TNK2 inhibitor (IC50= 16 nM and 77 nM for D163E and R806Q mutant TNK2, respectively)

CAS 664993-53-7 JW55

JW55
(CAS: 664993-53-7)

JW 55 is a potent and selective β-catenin signaling pathway inhibitor, which functions via inhibition of the PARP domain of tankyrase 1 and tankyrase 2 (TNKS1/2...

CAS 1038915-64-8 MK-4827 hydrochloride

MK-4827 hydrochloride
(CAS: 1038915-64-8)

MK-4827 HCl is a selective inhibitor of PARP1/PARP2 with IC50 of 3.8 nM/2.1 nM. It has a great activity in cancer cells with mutant BRCA-1 and BRCA-2, >330-fold...

CAS 3544-24-9 3-Aminobenzamide

3-Aminobenzamide
(CAS: 3544-24-9)

3-Aminobenzamide is a competitive PARP inhibitor with Ki of 1.8 μM.

NMS-P118
(CAS: 1262417-51-5)

NMS-P118 is a highly selective Poly(ADP-ribose) Polymerase 1 (PARP-1) inhibitor with excellent ADME, pharmacokinetic profiles and high efficacy in vivo originat...

Protease-Activated Receptor-2, amide

Protease-Activated Receptor-2, amide, also known as SLIGKV-NH2, is a highly potent protease-activated receptor-2 (PAR2) activating peptide and can also be utliz...

CAS 1190332-25-2 EB 47 dihydrochloride

EB 47 dihydrochloride
(CAS: 1190332-25-2)

EB 47 dihydrochloride is a PARP-1 inhibitor (IC50 = 45 nM) that reduces infarct volume in both a rat transient middle cerebral arterial occlusion model and a ca...

CAS 1048371-03-4 UPF 1069

UPF 1069
(CAS: 1048371-03-4)

UPF 1069 is a selective PARP2 inhibitor with IC50 of 0.3 μM. It is ~27-fold selective against PARP1.PARP activity is evaluated by utilizing commercially availab...

Chemical Structure

CAS 1065755-99-8 Parstatin (human)

Quick Inquiry

Verification code

Featured Items