Ofatumumab - CAS 679818-59-8
Catalog number: B0084-007213
Category: Inhibitor
Not Intended for Therapeutic Use. For research use only.
Molecular Formula:
C6480H10022N1742O2020S44
Molecular Weight:
146100
COA:
Inquire
Targets:
CD20
Description:
Ofatumumab is a CD20-directed cytolytic monoclonal antibody with an inhibitory effect on early-stage B lymphocyte. It was approved by FDA for its use to treat patients with chronic lymphocytic leukemia (CLL) as an extended treatment or in combination with chlorambucil. It also has the thearapeutic effect on some other diseases such as follicular lymphoma.
Publictions citing BOC Sciences Products
  • >> More
Brife Description:
CD20-directed cytolytic monoclonal antibody, chronic lymphocytic leukemia (CLL)
Sequence:
Light Chain:
EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPA
RFSGSGSGTDFTLTISSLEPEDFAVYYCQQRSNWPITFGQGTRLEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNR
Heavy Chain:
EVQLVESGGGLVQPGRSLRLSCAASGFTFNDYAMHWVRQAPGKGLEWVSTISWNSGSIGY
ADSVKGRFTISRDNAKKSLYLQMNSLRAEDTALYYCAKDIQYGNYYYGMDVWGQGTTVTV
SSASTKGPSVFPLAPGSSKSTSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQ
SSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
MSDS:
Inquire
Application:
the treatment of chronic lymphocytic leukemia (CLL)
Shelf Life:
2 years
Molecular Weight Calculator Molarity Calculator Solution Dilution Calculator

Quick Inquiry

Verification code

Featured Items