nivolumab - CAS 946414-94-4
Catalog number:
B0084-470957
Category:
Inhibitor
Not Intended for Therapeutic Use. For research use only.
COA:
Inquire
Targets:
PD-1
Description:
Nivolumab, marketed as Opdivo, is a humanized IgG4 anti-PD-1 monoclonal antibody used to treat cancer. Nivolumab works as a checkpoint inhibitor, blocking a signal that would have prevented activated T cells from attacking the cancer, thus allowing the immune system to clear the cancer.
Publictions citing BOC Sciences Products
  • >> More
Brife Description:
Marketed as Opdivo; A humanized IgG4 anti-PD-1 monoclonal antibody used to treat cancer; FDA Approved
Sequence:
Light Chain Sequence:
EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPA
RFSGSGSGTDFTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Heavy Chain Sequence:
QVQLVESGGGVVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSKRYY
ADSVKGRFTISRDNSKNTLFLQMNSLRAEDTAVYYCATNDDYWGQGTLVTVSSASTKGPS
VFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSS
VVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKP
KDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLT
VLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTC
LVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSV
MHEALHNHYTQKSLSLSLGK
Synonyms:
Opdivo; ONO-4538; BMS-936558; MDX1106
MSDS:
Inquire
Quality Standard:
In-house
Quantity:
Milli-Grams
Current Developer:
Bristol-Myers Squibb; Duke University Medical Center; Eli Lilly; Grupo Espanol Multidisciplinar de Melanoma; Incyte Corporation; Janssen Research & Development; Kyoto University; Kyowa Hakko Kirin; Medarex; National Cancer Institute (USA); Netherlands Cancer Institute; Ono Pharmaceutical; Seattle Genetics; Sidney Kimmel Comprehensive Cancer Center at Johns Hopkins; University of Texas M. D. Anderson Cancer Center
Molecular Weight Calculator Molarity Calculator Solution Dilution Calculator

Related PD-1 Products


Pidilizumab
(CAS: 1036730-42-3)

A humanized, immunoglobulin (Ig) G1 monoclonal antibody directed against human inhibitory receptor programmed cell death 1 (PD-1; PDCD1), with potential immune ...

pembrolizumab
(CAS: 1374853-91-4)

Pembrolizumab (formerly MK-3475 and lambrolizumab, trade name Keytruda) is a humanized antibody used in cancer immunotherapy. It targets the programmed cell dea...

MEDI0680

A humanized immunoglobulin (Ig) G4 monoclonal antibody directed against the negative immunoregulatory human cell surface receptor programmed cell death 1 (PD-1)...

nivolumab
(CAS: 946414-94-4)

Nivolumab, marketed as Opdivo, is a humanized IgG4 anti-PD-1 monoclonal antibody used to treat cancer. Nivolumab works as a checkpoint inhibitor, blocking a sig...

AMP-224

A fusion protein that contains the extracellular domain of PD-1 ligand 2 (B7-DC; PDCDILG2) and the Fc region of human immunoglobulin (Ig) G1. AMP-224 does not ...

Quick Inquiry

Verification code

Featured Items