MPDL3280A - CAS 1380723-44-3
Catalog number:
B0084-470960
Category:
Inhibitor
Not Intended for Therapeutic Use. For research use only.
COA:
Inquire
Targets:
PD-L1
Description:
A human, Fc optimized, monoclonal antibody directed against the protein ligand PD-L1 (programmed cell death-1 ligand 1), with potential immune checkpoint inhibitory and antineoplastic activities. Atezolizumab binds to PD-L1, blocking its binding to and activation of its receptor programmed death 1 (PD-1) expressed on activated T-cells, which may enhance the T-cell-mediated immune response to neoplasms and reverse T-cell inactivation. In addition, by binding to PD-L1, atezolizumab also prevents binding of this ligand to B7.1 expressed on activated T cells, which further enhances the T-cell-mediated immune response. PD-L1 is overexpressed on many human cancer cell types and on various tumor-infiltrating immune cells. PD-L1 binding to PD-1 on T-cells suppresses the immune system and results in increased immune evasion. PD-1, a transmembrane protein, is a negative regulator of the immune system that limits the expansion and survival of CD8+ T cells. The Fc region of atezolizumab is modified in such a way that it does not induce either antibody-dependent cytotoxicity (ADCC) or complement-dependent cytotoxicity (CDC).
Publictions citing BOC Sciences Products
  • >> More
Brife Description:
A human, Fc optimized, monoclonal antibody directed against the protein ligand PD-L1 (programmed cell death-1 ligand 1), with potential immune checkpoint inhibitory and antineoplastic activities.
Sequence:
Light Chain Sequence:
DIQMTQSPSSLSASVGDRVTITCRASQDVSTAVAWYQQKPGKAPKLLIYSASFLYSGVPS
RFSGSGSGTDFTLTISSLQPEDFATYYCQQYLYHPATFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Heavy Chain Sequence:
EVQLVESGGGLVQPGGSLRLSCAASGFTFSDSWIHWVRQAPGKGLEWVAWISPYGGSTYY
ADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARRHWPGGFDYWGQGTLVTVSSAS
TKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGL
YSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPS
VFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYAST
YRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMT
KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQ
GNVFSCSVMHEALHNHYTQKSLSLSPGK
Synonyms:
Atezolizumab; RG-7446; RO 5541267; TECENTRIQ
MSDS:
Inquire
Quality Standard:
In-house
Quantity:
Milli-Grams
Current Developer:
Chugai Pharmaceutical; Clovis Oncology; Columbia University; Genentech; Immune Design; Incyte Corporation; M. D. Anderson Cancer Center; Roche; University Medical Center Groningen; University of California at San Francisco; University of California System; Yale University
Molecular Weight Calculator Molarity Calculator Solution Dilution Calculator

Related PD-L1 Products


CA-170

A first-in-class oral, small molecule antagonist of PD-L1, PD-L2 and V-region immunoglobulin-containing suppressor of T cell activation (VISTA).

CAS 1673534-76-3 PD-1-IN-1

PD-1-IN-1
(CAS: 1673534-76-3)

PD-1-IN-1 is an inhibitor of programmed cell dealth-1 (PD-1).

BMS-936559

Anti-PD-L1 monoclonal antibody BMS-936559 binds to PD-L1, blocking its binding to and activation of its receptor programmed death 1 (PD-1), which may enhance th...

durvalumab
(CAS: 1428935-60-7)

Durvalumab is a human immunoglobulin G1 kappa (IgG1κ) monoclonal antibody. It was approved by FDA for the treatment of patients with locally advanced or metasta...

avelumab
(CAS: 1537032-82-8)

Avelumab is a human monoclonal antibody that is commonly used in immunotherapy and originally for non-small-cell lung carcinoma (NSCLC). It binds to the program...

PD-1/PD-L1 Inhibitor 1
(CAS: 1675201-83-8)

PD-1/PD-L1 Inhibitor 1, is an inhibitor of the PD-1 /PD-Ll protein/protein interaction.

MSB-0010718C

A human immunoglobulin G1 (IgG1) monoclonal antibody binds to PD-L1 and prevents the interaction of PD-L1 with its receptor PD-1, with potential immune checkpoi...

MPDL3280A
(CAS: 1380723-44-3)

A human, Fc optimized, monoclonal antibody directed against the protein ligand PD-L1 (programmed cell death-1 ligand 1), with potential immune checkpoint inhibi...

Quick Inquiry

Verification code

Featured Items