Etanercept - CAS 185243-69-0
Catalog number:
B0084-061626
Category:
Inhibitor
Not Intended for Therapeutic Use. For research use only.
Molecular Formula:
C2224H3472N618O701S36
COA:
Inquire
Publictions citing BOC Sciences Products
  • >> More
Sequence:
LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDST
YTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRK
CRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTS
TSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGDEPKSC
DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVD
GVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK
GQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDS
DGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Purity:
95%
MSDS:
Inquire
Quantity:
Data not available, please inquire.
1.Golimumab in refractory uveitis related to spondyloarthritis. Multicenter study of 15 patients.
Calvo-Río V1, Blanco R1, Santos-Gómez M1, Rubio-Romero E2, Cordero-Coma M3, Gallego-Flores A4, Veroz R4, Torre I5, Hernández FF6, Atanes A7, Loricera J1, González-Vela MC1, Palmou N1, Hernández JL8, González-Gay MA9. Semin Arthritis Rheum. 2016 Mar 9. pii: S0049-0172(16)00092-5. doi: 10.1016/j.semarthrit.2016.03.002. [Epub ahead of print]
OBJECTIVE: To assess the efficacy of golimumab (GLM) in refractory uveitis associated to spondyloarthritis (SpA).
2.The lived experience of juvenile idiopathic arthritis in young people receiving etanercept.
Livermore P1, Eleftheriou D2, Wedderburn LR2. Pediatr Rheumatol Online J. 2016 Apr 12;14(1):21. doi: 10.1186/s12969-016-0083-7.
BACKGROUND: This study explores young people's daily experiences of living with Juvenile Idiopathic Arthritis (JIA) and their thoughts, beliefs and feelings related to the biological drug Etanercept, prescribed as part of their treatment.
3.[Development of mesangial immunoglobulin IgA glomerulonephritis and p-ANCA positivity in a patient with psoriatic arthritis].
Nazzaro P, Battaglia R, D'Altri C, Marangi AL, Perniola M, Rodio A, De Padova F. G Ital Nefrol. 2016 Mar-Apr;33(2). pii: gin/33.2.11.
Tumor necrosis factor (TNF) inhibitors are widely used for the treatment of various rheumatic diseases. These agents may lead to development of systemic autoimmune diseases and renal complications. We report a patient with psoriatic arthritis and renal failure treated with two TNF inhibitors (Etanercept and then Adalimumab). After this treatment he developed proteinuria with nephrotic syndrome. A renal biopsy was performed highlighting GN with mesangial IgA deposits. Then he developed p-ANCA positivity. Following that, etanercept and adalimumab were stopped and a treatment by corticosteroids was initiated, but renal function decreased. Currently the patient is treated by haemodialysis. In our patient, the pathogenic role for anti-TNF therapy is suggested by the close temporal relationship with development of glomerular disease and by the improvement in proteinuria after drug withdrawal. However, the patient was treated once more with TNF agents, so he developed end stage renal disease.
4.Different Risk of Tuberculosis and Efficacy of Isoniazid Prophylaxis in Rheumatoid Arthritis Patients with Biologic Therapy: A Nationwide Retrospective Cohort Study in Taiwan.
Liao TL1,2, Lin CH1,3, Chen YM1,2,4, Chang CL1, Chen HH1,4, Chen DY1,2,4,5. PLoS One. 2016 Apr 11;11(4):e0153217. doi: 10.1371/journal.pone.0153217. eCollection 2016.
Increasing evidence indicates an increased risk of tuberculosis (TB) for rheumatoid arthritis (RA) patients receiving biologic therapy, and the effectiveness of isoniazid prophylaxis (INHP) in TB prevention. We aimed to examine 1) the incidence rate (IR) and risk factors for TB among RA patients receiving different therapies; 2) INHP effectiveness for TB prevention; 3) mortality rates after TB diagnosis in patients receiving different therapies. This retrospective study was conducted using a nationwide database: 168,720 non-RA subjects and a total of 42,180 RA patients including 36,162 csDMARDs-exposed, 3,577 etanercept-exposed, 1,678 adalimumab-exposed and 763 rituximab-exposed patients. TB risk was 2.7-fold higher in RA cohort compared with non-RA group, with an adjusted hazard ratio (aHR) of 2.58. Advanced age, male, the use of corticosteroids≧5mg/day, and the presence of diabetes mellitus (DM), chronic obstructive pulmonary disease and chronic kidney disease were risk factors for developing TB.
Molecular Weight Calculator Molarity Calculator Solution Dilution Calculator

Quick Inquiry

Verification code

Featured Items