Calcitonin salmon - CAS 47931-85-1
Category:
Inhibitor
Not Intended for Therapeutic Use. For research use only.
Molecular Formula:
C145H240N44O48S2
Molecular Weight:
3431.85
COA:
Inquire
Targets:
Others
Description:
Calcitonin salmon, a calcium regulating hormone, has been shown to be an effective alternative for the treatment of postmenopausal osteoporosis.
Publictions citing BOC Sciences Products
  • >> More
Sequence:
CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP
Synonyms:
H-Cys(1)-Ser-Asn-Leu-Ser-Thr-Cys(1)-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2; L-cysteinyl-L-seryl-L-asparagyl-L-leucyl-L-seryl-L-threonyl-L-cysteinyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-leucyl-L-seryl-L-glutaminyl-L-alpha-glutamyl-L-leucyl-L-histidyl-L-lysyl-L-leucyl-L-glutaminyl-L-threonyl-L-tyrosyl-L-prolyl-L-arginyl-L-threonyl-L-asparagyl-L-threonyl-glycyl-L-seryl-glycyl-L-threonyl-L-prolinamide (1->7)-disulfide
Solubility:
DMSO
Storage:
Store in a cool and dry place (or refer to the Certificate of Analysis).
MSDS:
Inquire
Density:
1.54±0.1 g/cm3
InChIKey:
BBBFJLBPOGFECG-VJVYQDLKSA-N
InChI:
1S/C145H240N44O48S2/c1-65(2)45-86(175-139(232)110(70(11)12)183-136(229)99-63-239-238-62-79(148)117(210)178-96(59-191)134(227)174-92(52-104(151)202)131(224)172-90(49-69(9)10)129(222)180-98(61-193)135(228)187-114(74(16)197)142(235)181-99)118(211)158-55-106(204)162-80(25-18-20-40-146)120(213)169-89(48-68(7)8)128(221)179-97(60-192)133(226)167-83(34-37-102(149)200)122(215)165-85(36-39-109(207)208)123(216)171-88(47-67(5)6)127(220)173-91(51-77-54-156-64-161-77)130(223)164-81(26-19-21-41-147)121(214)170-87(46-66(3)4)126(219)166-84(35-38-103(150)201)125(218)186-113(73(15)196)141(234)177-94(50-76-30-32-78(199)33-31-76)143(236)189-44-24-29-101(189)137(230)168-82(27-22-42-157-145(154)155)124(217)185-112(72(14)195)140(233)176-93(53-105(152)203)132(225)184-111(71(13)194)138(231)160-56-107(205)163-95(58-190)119(212)159-57-108(206)182-115(75(17)198)144(237)188-43-23-28-100(188)116(153)209/h30-33,54,64-75,79-101,110-115,190-199H,18-29,34-53,55-63,146-148H2,1-17H3,(H2,149,200)(H2,150,201)(H2,151,202)(H2,152,203)(H2,153,209)(H,156,161)(H,158,211)(H,159,212)(H,160,231)(H,162,204)(H,163,205)(H,164,223)(H,165,215)(H,166,219)(H,167,226)(H,168,230)(H,169,213)(H,170,214)(H,171,216)(H,172,224)(H,173,220)(H,174,227)(H,175,232)(H,176,233)(H,177,234)(H,178,210)(H,179,221)(H,180,222)(H,181,235)(H,182,206)(H,183,229)(H,184,225)(H,185,217)(H,186,218)(H,187,228)(H,207,208)(H4,154,155,157)/t71-,72-,73-,74-,75-,79+,80+,81+,82+,83+,84+,85+,86+,87+,88+,89+,90+,91+,92+,93+,94+,95+,96+,97+,98+,99+,100+,101+,110+,111+,112+,113+,114+,115+/m1/s1
Canonical SMILES:
CC(C)CC1C(=O)NC(C(=O)NC(C(=O)NC(CSSCC(C(=O)NC(C(=O)NC(C(=O)N1)CC(=O)N)CO)N)C(=O)NC(C(C)C)C(=O)NC(CC(C)C)C(=O)NCC(=O)NC(CCCCN)C(=O)NC(CC(C)C)C(=O)NC(CO)C(=O)NC(CCC(=O)N)C(=O)NC(CCC(=O)O)C(=O)NC(CC(C)C)C(=O)NC(CC2=CN=CN2)C(=O)NC(CCCCN)C(=O)NC(CC(C)C)C(=O)NC(CCC(=O)N)C(=O)NC(C(C)O)C(=O)NC(CC3=CC=C(C=C3)O)C(=O)N4CCCC4C(=O)NC(CCCNC(=N)N)C(=O)NC(C(C)O)C(=O)NC(CC(=O)N)C(=O)NC(C(C)O)C(=O)NCC(=O)NC(CO)C(=O)NCC(=O)NC(C(C)O)C(=O)N5CCCC5C(=O)N)C(C)O)CO
Molecular Weight Calculator Molarity Calculator Solution Dilution Calculator

Related Products


CAS 370586-05-3 CID-797718

CID-797718
(CAS: 370586-05-3)

CAS 523-50-2 Isopsoralen

Isopsoralen
(CAS: 523-50-2)

Angelicin is a furanocoumarin isolated from P. corylifolia might be a potential new agent for prevention of inflammatory reactions.

ABT-515
(CAS: 189328-52-7)

CAS 491-54-3 Kaempferide

Kaempferide
(CAS: 491-54-3)

Kaempferide is an O-methylated flavonol. It can be found in Kaempferia galanga (aromatic ginger). The enzyme kaempferol 4'-O-methyltransferase uses S-adenosyl-L...

CAS 939981-37-0 p53 and MDM2 proteins-interaction-inhibitor chiral

p53 and MDM2 proteins-interaction-inhibi
(CAS: 939981-37-0)

p53 and MDM2 proteins-interaction-inhibitor chiral is an inhibitor of the interaction between p53 and MDM2 proteins.

CAS 321915-72-4 Albitiazolium bromide

Albitiazolium bromide
(CAS: 321915-72-4)

Albitiazolium bromide is a choline analogue acts as a cholinergic receptor antagonists, inhibits choline transport into Plasmodium-infected erythrocytes, thus p...

CAS 2719-05-3 FH1

FH1
(CAS: 2719-05-3)

FH1 (BRD-K4477) is a small molecule, which promotes the maturation and differentiation of induced pluripontent stem cells (iPSCs) to hepatocytes. FH 1 treatment...

CHF 1255
(CAS: 146728-52-1)

CHF 1255, a tetrahydronaphthalen derivative, has been found to be probably effective against heart failure.

CAS 478-01-3 Nobiletin

Nobiletin
(CAS: 478-01-3)

Nobiletin, a citrus flavonoid isolated from citrus peels like in tangerine, which has anti-inflammatory and anti-tumor activities.

CAS 66-97-7 Psoralen

Psoralen
(CAS: 66-97-7)

Psoralen is an active ingredient from Fructus Psoraleae and has anticancer activity.

CAS 105462-24-6 Risedronate

Risedronate
(CAS: 105462-24-6)

Risedronate is a bisphosphonate used to strengthen bone, treat or prevent osteoporosis, and treat Paget's disease of bone.

UK 34787
(CAS: 72818-36-1)

UK 34787 is a thromboxane inhibitor,but no detailed information has been published yet.

JNJ-10329670
(CAS: 400797-24-2)

JNJ-10329670 represents a novel class of immunosuppressive compounds with a highly potent (Ki ~30 nM)

CP-67015
(CAS: 100325-51-7)

CP-67015 has inhibitory effect on topoisomerase function. It is a direct-acting mutagen in mammalian cells with both gene and chromosomal level effects.

BPH715
(CAS: 1059677-23-4)

BPH715 is a new generation of lipophilic bisphosphonates. It is potent in cell culture and effectively inhibited tumor cell growth and invasiveness. It is used ...

CAS 86541-74-4 Benazepril HCl

Benazepril HCl
(CAS: 86541-74-4)

Benazepril is a drug of the angiotensin-converting enzyme (ACE) inhibitor used to treat high blood pressure.

CAS 587-63-3 Dihydrokavain

Dihydrokavain
(CAS: 587-63-3)

Dihydrokavain is a kavalactone source from kava beverages used in herbal medicine to treat sleep disturbances, as well as stress and anxiety.

WRR483
(CAS: 1076088-50-0)

WRR483 is a potent and selective cysteine protease inhibitor with trypanocidal activity in cell culture and animal model. It is an analogue of K-11777. It demon...

PLX-7683
(CAS: 1652573-86-8)

PLX-7683, a pyrrolopyridine derivative, has been found to be a paradox breaker that was studied to exhibit more durable efficacy and better safety than some for...

UK-371804
(CAS: 256477-09-5)

UK-371804 is a novel and selective inhibitors of urokinase plasminogen activator (uPA). UK-371804 exhibits excellent enzyme potency (Ki 10 nM) and selectivity p...

Chemical Structure

CAS 47931-85-1 Calcitonin salmon

Quick Inquiry

Verification code

Featured Items