Bevacizumab - CAS 216974-75-3
Catalog number: B1335-180515
Category: Metabolites
Molecular Formula:
C6638H10160N1720O2108S44
Molecular Weight:
149146.82
COA:
Inquire
source\Analogue Sets:
Others
Description:
Bevacizumab is an angiogenesis inhibiting monoclonal antibody which is commonly used to treat certain metastatic cancers. It acts via inhibiting vascular endothelial growth factor A (VEGF-A).
Brife Description:
angiogenesis inhibiting monoclonal antibody, certain metastatic cancers
Sequence:
light chain:
DIQMTQSPSSLSASVGDRVTITCSASQDISNYLNWYQQKPGKAPKVLIYFTSSLHSGVPS
RFSGSGSGTDFTLTISSLQPEDFATYYCQQYSTVPWTFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
heavy chain:
EVQLVESGGGLVQPGGSLRLSCAASGYTFTNYGMNWVRQAPGKGLEWVGWINTYTGEPTY
AADFKRRFTFSLDTSKSTAYLQMNSLRAEDTAVYYCAKYPHYYGSSHWYFDVWGQGTLVT
VSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVL
QSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEL
LGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREE
QYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPS
REEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDK
SRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Purity:
(HPLC): Not less than 98.0%
Appearance:
Liquid
Synonyms:
Avastin; Anti-vegf monoclonal antibody; Immunoglobulin G1, anti-(human vascular endothelial growth factor) (human-mouse monoclonal rhumab-vegf gamma1-chain), disulfide with human-mouse monoclonal rhumab-vegf light chain, dimer; Rhumab-vegf; Unii-2S9zzm9Q9v
Storage:
≤30°C
MSDS:
Inquire
Application:
the treatment of certain metastatic cancers
Shelf Life:
2 years
Molecular Weight Calculator Molarity Calculator Solution Dilution Calculator

Related Products


23-O-Desmycinosyl-tylosin
(CAS: 79592-92-0)

An impurity derived from the macrolide antibiotic, tylosin

CAS 320-67-2 5-Azacytidine

5-Azacytidine
(CAS: 320-67-2)

A nucleoside analog of cytidine; used to treat myelodysplasic syndrome (MDS)

CAS 4611-05-6 Ophiobolin A

Ophiobolin A
(CAS: 4611-05-6)

The dominant member of a class of phytotoxic metabolites produced by plant pathogenic fungi

CAS 4229-44-1 N-Methylhydroxylamine hydrochloride

N-Methylhydroxylamine hydrochloride
(CAS: 4229-44-1)

A catalyst commonly used in transamidation; has radical scavenger abilities as a bacterial growth inhibitor

Epi-doramectin

A base-catalysed intermediate in the decomposition of doramectin; formed by epimerisation at the 2-position which ultimately rearranges irreversibly to the isom...

Gageostatin A

An antimicrobial peptide (AMP) isolated from a marine strain of bacillus subtilis; a linear lipopeptide composed of 7 peptides; has shown initial bioactivity ag...

LL Z1640-2
(CAS: 66018-38-0)

A cis-enone resorcylic acid lactone; an irreversible and highly selective TAK 1 inhibitor; a MAPKKK involved in the p38 signalling cascade for pro-inflammation ...

CAS 134678-17-4 Lamivudine

Lamivudine
(CAS: 134678-17-4)

A cytidine analog and antiretroviral medication commonly used to treat HIV and hepatitis B infections

Quick Inquiry

Verification code

Featured Items