avelumab - CAS 1537032-82-8
Catalog number:
B0084-007091
Category:
Inhibitor
Not Intended for Therapeutic Use. For research use only.
COA:
Inquire
Targets:
PD-L1
Description:
Avelumab is a human monoclonal antibody that is commonly used in immunotherapy and originally for non-small-cell lung carcinoma (NSCLC). It binds to the programmed death-ligand 1 (PD-L1) preventing the combination of PD-L1 and its receptor programmed cell death 1 (PD-1), which leads to the inhibition of CD8+ T cells. In January 2017 it received orphan drug designation by the European Medicines Agency for the treatment of gastric cancer; In March 2017, it was approved by FDA to treat patients with Merkel-cell carcinoma.
Publictions citing BOC Sciences Products
  • >> More
Brife Description:
human monoclonal antibody, PD-L1, NSCLC, gastric cancer, Merkel-cell carcinoma
Sequence:
Light chain:
QSALTQPASVSGSPGQSITISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIYDVSNRPSGV
SNRFSGSKSGNTASLTISGLQAEDEADYYCSSYTSSSTRVFGTGTKVTVLGQPKANPTVT
LFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASS
YLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Heavy chain:
EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYIMMWVRQAPGKGLEWVSSIYPSGGITFY
ADTVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARIKLGTVTTVDYWGQGTLVTVSS
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS
GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGG
PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN
STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDE
LTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW
QQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Synonyms:
Bavencio
MSDS:
Inquire
Application:
the treatment of gastric cancer and Merkel-cell carcinoma
Shelf Life:
2 years
Current Developer:
EMD Serono (Merck KGaA), Pfizer
Molecular Weight Calculator Molarity Calculator Solution Dilution Calculator

Related PD-L1 Products


BMS-936559

Anti-PD-L1 monoclonal antibody BMS-936559 binds to PD-L1, blocking its binding to and activation of its receptor programmed death 1 (PD-1), which may enhance th...

MSB-0010718C

A human immunoglobulin G1 (IgG1) monoclonal antibody binds to PD-L1 and prevents the interaction of PD-L1 with its receptor PD-1, with potential immune checkpoi...

durvalumab
(CAS: 1428935-60-7)

Durvalumab is a human immunoglobulin G1 kappa (IgG1κ) monoclonal antibody. It was approved by FDA for the treatment of patients with locally advanced or metasta...

PD-1/PD-L1 Inhibitor 1
(CAS: 1675201-83-8)

PD-1/PD-L1 Inhibitor 1, is an inhibitor of the PD-1 /PD-Ll protein/protein interaction.

avelumab
(CAS: 1537032-82-8)

Avelumab is a human monoclonal antibody that is commonly used in immunotherapy and originally for non-small-cell lung carcinoma (NSCLC). It binds to the program...

CA-170

A first-in-class oral, small molecule antagonist of PD-L1, PD-L2 and V-region immunoglobulin-containing suppressor of T cell activation (VISTA).

MPDL3280A
(CAS: 1380723-44-3)

A human, Fc optimized, monoclonal antibody directed against the protein ligand PD-L1 (programmed cell death-1 ligand 1), with potential immune checkpoint inhibi...

CAS 1673534-76-3 PD-1-IN-1

PD-1-IN-1
(CAS: 1673534-76-3)

PD-1-IN-1 is an inhibitor of programmed cell dealth-1 (PD-1).

Quick Inquiry

Verification code

Featured Items