Adalimumab - CAS 331731-18-1
Catalog number:
B0084-179159
Category:
Inhibitor
Not Intended for Therapeutic Use. For research use only.
Molecular Formula:
C6428H9912N1694O1987S46
Molecular Weight:
144190.3
COA:
Inquire
Description:
Adalimumab is a monoclonal antibody with an anti-inflammatory property. It is commonly used for the treatment of rheumatoid arthritis, psoriatic arthritis, ankylosing spondylitis, etc. Adalimumab can prevent infections via binding to tumor necrosis factor-alpha (TNFα).
Publictions citing BOC Sciences Products
  • >> More
Brife Description:
anti-inflammatory antiboby, infections
Sequence:
Light chain:
DIQMTQSPSSLSASVGDRVTITCRASQGIRNYLAWYQQKPGKAPKLLIYAASTLQSGVPS
RFSGSGSGTDFTLTISSLQPEDVATYYCQRYNRAPYTFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Heavy chain:
EVQLVESGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSAITWNSGHIDY
ADSVEGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAKVSYLSTASSLDYWGQGTLVTVS
SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS
SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Synonyms:
CHEMBL166124; SCHEMBL7720091; SCHEMBL7720094; 10-[(E)-Benzylidene]-2,8-cyclodecadiyne-1-ol
MSDS:
Inquire
Shelf Life:
2 years
1.A comparison of three assays to quantify infliximab, adalimumab and etanercept serum concentrations.
van Bezooijen JS1, Koch BC, Doorn MV, Prens EP, Gelder TV, Schreurs MW. Ther Drug Monit. 2016 Apr 26. [Epub ahead of print]
BACKGROUND: To optimize treatment of inflammatory diseases, interest in the measurement of anti- tumor necrosis factor alpha (anti-TNFα) serum drug concentrations is increasing. Preferably, assays for the detection of these drugs should be compared using the same reference material. In the current study two commercially available ELISAs and a commercially available bioassay for the determination of anti-TNFα drugs are compared.
2.Adalimumab for Moderately to Severely Active Ulcerative Colitis: A Systematic Review and Meta-Analysis.
Chen X1, Hou J2, Yuan Y3, Huang C4, Liu T5, Mo C1, Li H4, Chen B2, Xu Q1, Hou Z2, He W6, Liu F7. BioDrugs. 2016 Apr 27. [Epub ahead of print]
BACKGROUND: Evidence-based studies are increasingly being focused on evaluating the efficacy and safety of adalimumab (ADA) for moderately to severely active ulcerative colitis (UC). However, the dosage pattern of ADA for UC management is still not clear.
3.Transferrin Level Before Treatment and Genetic Polymorphism in HFE Gene as Predictive Markers for Response to Adalimumab in Crohn's Disease Patients.
Repnik K1,2, Koder S3, Skok P3, Ferkolj I4, Potočnik U5,6. Biochem Genet. 2016 Apr 26. [Epub ahead of print]
Tumor necrosis factor α inhibitors (anti-TNF) have improved treatment of several complex diseases, including Crohn's disease (CD). However, the effect varies and approximately one-third of the patients do not respond. Since blood parameters as well as genetic factors have shown a great potential to predict response during treatment, the aim of the study was to evaluate response to anti-TNF treatment with adalimumab (ADA) between genes HFE and TF and haematological parameters in Slovenian refractory CD patients. Single nucleotide polymorphisms (SNPs) rs1799852 in gene TF and rs2071303 in gene HFE were genotyped in 68 refractory CD patients for which response has been measured using inflammatory bowel disease questionnaire (IBDQ) index. Haematological parameters and IBDQ index were determined before therapy and after 4, 12, 20 and 30 weeks. We found novel strong association between SNP rs2071303 in gene HFE and response to ADA treatment, particularly patients with G allele comparing to A allele had better response after 20 weeks (p = 0.
Molecular Weight Calculator Molarity Calculator Solution Dilution Calculator

Quick Inquiry

Verification code

Featured Items